PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_178.19
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HD-ZIP
Protein Properties Length: 699aa    MW: 78594.5 Da    PI: 6.8737
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_178.19genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.94.1e-192782156
                                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                  +r+ ++++++q++ Le +Fe++++p++++r++L+++lgL+ +qVk+WFqN+R++ +
  evm.model.supercontig_178.19 27 KRTHHRHNSSQIQHLELFFENCPHPDESQRRQLSRELGLDPKQVKFWFQNKRTQTR 82
                                  6788899*********************************************9987 PP

2START124.41.4e-392454643206
                                   HHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT- CS
                         START   3 aeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWd 73 
                                   a +a++elv++ +++ep+W +s          +d++ ++f++ ++     +++e +++sg+ +m+   l e ++d   +W+
  evm.model.supercontig_178.19 245 AASAMDELVRLLSVNEPLWIRSEssgsrAVIHRDTYEKIFPKVNGfknmnSRIESSKESGMIIMNGSHLIEMIMDPV-KWT 324
                                   6789******************98877655678888899988888999*****************************.*** PP

                                   TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSE CS
                         START  74 etla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvv 143
                                     ++    kae l  ++ g      + l lm+ ++  lsplvp R+f ++R +rql+ag wv vdvS d +++        
  evm.model.supercontig_178.19 325 DLFPtivcKAEKLYEVQAGasgnknSCLLLMYEQMHILSPLVPaREFIILRNCRQLEAGLWVMVDVSYDLKDHTRP----- 400
                                   ********77777777777788999************************************************986..... PP

                                   E-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                         START 144 RaellpSgiliepksnghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                                   R+ +lpSg++i++++ng skv+w+ehv++++++  h+l+r l+ sg a ga +w  +lqr ce+
  evm.model.supercontig_178.19 401 RCWKLPSGCMIQDMANGCSKVIWIEHVEVDDKILtHQLYRDLLCSGSAYGAERWIVALQRICER 464
                                   ********************************999***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-181186IPR009057Homeodomain-like
SuperFamilySSF466893.01E-171484IPR009057Homeodomain-like
PROSITE profilePS5007116.7142484IPR001356Homeobox domain
SMARTSM003892.1E-152688IPR001356Homeobox domain
PfamPF000461.3E-162782IPR001356Homeobox domain
CDDcd000861.11E-162785No hitNo description
PROSITE patternPS0002705982IPR017970Homeobox, conserved site
PROSITE profilePS5084840.236234467IPR002913START domain
SuperFamilySSF559611.79E-27236465No hitNo description
CDDcd088753.61E-97238463No hitNo description
SMARTSM002342.4E-27243464IPR002913START domain
PfamPF018529.2E-33245464IPR002913START domain
SuperFamilySSF559615.86E-5534690No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 699 aa     Download sequence    Send to blast
MDIAMGNSGT NNSSEEQRTS NRSDSEKRTH HRHNSSQIQH LELFFENCPH PDESQRRQLS  60
RELGLDPKQV KFWFQNKRTQ TRAQSERADN SALREENERI QCENLAIREA LKNAICPACG  120
GPPFGLEERQ RSLQKLRMEN AQLKEEHEKV SNFLAKYTGK PVSQFEEMSS PTRGKGPSNA  180
FDSLPPSYST QIGFPSVDNL DNFIQKYQEN IGNNLSVNNR VIDHRQYFDP WLISDVEKAF  240
MVETAASAMD ELVRLLSVNE PLWIRSESSG SRAVIHRDTY EKIFPKVNGF KNMNSRIESS  300
KESGMIIMNG SHLIEMIMDP VKWTDLFPTI VCKAEKLYEV QAGASGNKNS CLLLMYEQMH  360
ILSPLVPARE FIILRNCRQL EAGLWVMVDV SYDLKDHTRP RCWKLPSGCM IQDMANGCSK  420
VIWIEHVEVD DKILTHQLYR DLLCSGSAYG AERWIVALQR ICERLTFSKT ENSCDSNHSS  480
VMSNGMKSML KLCHRMIKDF CARLCMSCDN KLDFPHMHDV NSSGVRVCVH EGIGPSQPNG  540
TIVSATSSLW LPLPPLRVFN FFKDENMRNK PFNPTENGMV MLQESFIDSL GGMVVYAPID  600
VPAMNVAITG DDINKSIPIL PSGFVISTDG RQNNTGGAST SADTSLGMRR GGGSLITVVF  660
QVVVSTKDLN MESVATVKNL ISSTIQRIKD VLNCSNIE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002526595.20.0PREDICTED: homeobox-leucine zipper protein ROC8 isoform X2
TrEMBLV4S6730.0V4S673_9R
STRINGPOPTR_0004s07310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2405323
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11